1. Browse the Database
  2. View Redoxidase
Entry information : SmPrx88-2_26 (SmPrx88b_26)
Entry ID 7121
Creation 2009-10-30 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: SmPrx88-2_26 (SmPrx88b_26)
Name (synonym) SmPrx88-2_26 (SmPrx88b_26)
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx88-2_26
start..stop		 S start..stop
SmPrx88-1_24 644 0 1..321 1..320
SmPrx87-1_24 424 1.65e-150 9..321 9..320
SmPrx87-2_26 424 2.03e-150 6..321 6..320
SmPrx64-1_19 368 2.66e-128 24..317 38..322
Gene structure Fichier Exons►


exon

Literature and cross-references SmPrx88-2_26 (SmPrx88b_26)
DNA ref. Phytozome 12:   scaffold_26 (1890041..1888874)
Protein sequence: SmPrx88-2_26 (SmPrx88b_26)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (297)
PWM (Da):   %s   33959.62 (31273.3)  
PI (pH):   %s   4.58 (4.64) Peptide Signal:   %s   cut: 25 range:25-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDRFGAWWWSSVIAVLLLGLEANAQLSSSFYSSTCPNLTDIVRNV
IQSAVANENRMAASILRLHFHDCFVNGCDGSVLLQGGEENAPPNQRSARGFEVIDSVKSAVESACPGVVSCADILALSAHESVTAVLGGPSWTVVFGRRDSLSPASVTDVSANLPGPGFTALRLIRSFQNQDLSPRDLVALSGGHT
IGQAQCFTFRARLYNGTAGDSIDPALKSRLEQNCPPSAPNGDRNLENLDTSPATFDNTYFQLLQSTQGLLFSDQQLLSGGQSELASMVNEFAGDQQAFFTAFANGMVSMGNLSPLTGSSG
EIRATCRSSN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect transcript prediction from JGI (fusion of two exon 1 from one ORF with exons 2,3,4 from a second ORF).
DNA ►
Send to BLAST
CDS►
Send to BLAST