1. Browse the Database
  2. View Redoxidase
Entry information : ZmPrx27(Zm00001d053839 /)
Entry ID 723
Creation 2005-06-13 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-04 (Christophe Dunand)
Peroxidase information: ZmPrx27(Zm00001d053839 /)
Name ZmPrx27(Zm00001d053839 /)
Class Class III peroxidase    [Orthogroup: Prx147]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx27
start..stop		 S start..stop
SbPrx70 568 0 1..342 14..352
SiPrx71 538 0 11..340 17..343
TaPrx129-1A 464 8.61e-166 13..340 7..326
TaPrx129-1D 461 1.42e-164 29..340 40..343
Gene structure Fichier Exons►


exon

Literature and cross-references ZmPrx27(Zm00001d053839 /)
Literature Walbot,V., unpublished
Protein ref. UniProtKB:   B4FB95
DNA ref. GenBank:   AC196154.3 (125957..129027)
Protein sequence: ZmPrx27(Zm00001d053839 /)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (321)
PWM (Da):   %s   35522.25 (33522.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.44 (7.44) Peptide Signal:   %s   cut: 22 range:22-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVVPAAPVVLGVAMVLVVLAASAGAAGQLRMGFYAESCPGVERV
VGDFVRQHVRRVPTVAAALLRLHFHDCFVRGCDASVLLNSTAGSVAEKDAPPNLTLRGFDLVDRVKALVEDACPGVVSCADVLALAARDAVVAIGGPSWRVATGRRDGTVSAMQEALDDIPKHTMTFPQLASLFASKGLGVRDLVWLSGA
HTIGIAHCSSFADRLYGYPGGGVGAAGNDTADPALDATYAANLRRRKCRAAGGGYAEDGVVEMDPGSHLTFDLGYYRALLKRRGLLRSDAALLTDAAARADVEGVAAGPEEVFFQLFARS
MARLAALQVKTGAEGEVRRNCAVVNGG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 39 + 6 ESTs. Incorrect prediction from Phytozome (last exon is not predicted)
DNA ►
Send to BLAST
CDS►
Send to BLAST