Entry information : PpaPrxII0302 (PpaPrxIIC02)
Entry ID 7422
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-03 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: PpaPrxII0302 (PpaPrxIIC02)
Name (synonym) PpaPrxII0302 (PpaPrxIIC02)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrxII0302
start..stop
S start..stop
PmaPrxII03 213 3.82e-72 1..160 3..162
SmPrxII03-1_20 210 8.75e-71 1..157 3..159
PtPrxII03 209 1.4e-70 1..160 3..162
PbPrxII03 209 1.4e-70 1..160 3..162
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7422' 'join(29770..29998,30123..30406)' Exons


exon

Literature and cross-references PpaPrxII0302 (PpaPrxIIC02)
DNA ref. Phytozome 12:   scaffold_310 (29770..30406)
Protein sequence: PpaPrxII0302 (PpaPrxIIC02)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18861.76  
PI (pH):   %s   6.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PIGVGDKIPNGELTYLDGCGKLQTHLIYDLVREKRVVFFGVPGAFTPTCSLKHVPGFIERAAEILDRGINEIVCITVNDPFVVKEWEKTYPENKHVRFLCDGSAIWTKKIGLELDLYDRG
MGVRSRRYSLMICDTVVRIANIEEGGGLETSTASRMLKDLNTGKDMVLPP

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). ATG is missing (sequencing error or pseudogene?). No EST.
DNA
Send to BLAST
CDS
Send to BLAST