1. Browse the Database
  2. View Redoxidase
Entry information : Hcy1CysPrx
Entry ID 7613
Creation 2010-09-21 (Christophe Dunand)
Last sequence changes 2010-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: Hcy1CysPrx
Name Hcy1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue types Hyphae
Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Hcy1CysPrx
start..stop		 S start..stop
Lbi1CysPrx 423 2.27e-153 1..222 1..222
Amus1CysPrx 409 1.4e-147 1..222 1..222
Athi1CysPrx01 407 3.41e-147 1..222 1..222
Pc1CysPrx01 400 3.8e-144 1..222 1..222
Gene structure Fichier Exons►


exon

Literature and cross-references Hcy1CysPrx
DNA ref. JGI genome:   scaffold_3 (659790..660781)
EST ref. GenBank:   CK994821.1 [5' end]  CK993882.1 [3' end]
Protein sequence: Hcy1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222 (309)
PWM (Da):   %s   24896.93 (34452.2)  
PI (pH):   %s   6.25 (6.75) Peptide Signal:   %s   cut: 18 range:18-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGNIAPDFEAQTTAGPIKFHDWIGDSWAILFSHPGDFTPVCTTELGEVARRSKDFEKRNVKVIGISANGLDEHEKWVKDINEYGSKVAPTEVEFPIIADPDRKISTLYDMLDEQDATNRDAKGLPFTIRTVFVIDPKKTIRLTLAYP
ASTGRNFDEIIRVISLQIGDKHRVTTPVNWKKGEDVIVHPGVTNEEAKTLFPQFSQHLPYLRTTPLKV

Retrieve as FASTA  
Remarks Complete sequence from 9 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST