1. Browse the Database
  2. View Redoxidase
Entry information : SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Entry ID 7937
Creation 2011-01-21 (Toky Ramarohetra)
Last sequence changes 2011-03-02 (Catherine Mathe)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Name (synonym) SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2007]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbGPx07
start..stop		 S start..stop
ZmGPx03-2 301 5.39e-107 1..163 1..163
ZmGPx01-3 292 2.6e-103 1..163 1..164
ZmGPx01 289 4.13e-102 2..164 5..167
SpGPx01 288 9e-102 1..164 1..167
Gene structure Fichier Exons►


exon

Literature and cross-references SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
DNA ref. Phytozome 12:   chromosome_1 (59588879..59585905)
Protein sequence: SbGPx07 (Sb01g035940 [2.1] / Sobic.001G378700.1 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   165
PWM (Da):   %s   18291.4 Transmb domain:   %s   i13-30o
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSLHDFIVKDASGKDVHLSTYKGKVLLIVNVASKCGLTNSNYTELTQLYEMYKDGFEILAFPCNQFGGQEPATSEEIVQFVCTRFTAKFPIFDVDVNGEDAAPIYKFLKSSKTGPF
GENIKWNFAKFLVDKKGHVIERYAPTTYPLSIQKDIKKLLGSY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 6 introns). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST