Entry information : AtPrx04(At1g14540 / PER4 / AtP46)
Entry ID 80
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-03-04 (Christophe Dunand)
Peroxidase information: AtPrx04(At1g14540 / PER4 / AtP46)
Name AtPrx04(At1g14540 / PER4 / AtP46)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Senescing leaves
Inducer Senescence
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx04
start..stop
S start..stop
AlyPrx04 617 0 1..315 1..316
BstrPrx77 598 0 1..315 1..316
AhalPrx45 598 0 1..315 1..323
CagraPrx58 597 0 1..315 1..316
Gene structure Fichier Exons


exon

Literature and cross-references AtPrx04(At1g14540 / PER4 / AtP46)
Literature REFERENCE 1 Rasul S, Dubreuil-Maurizi C, Lamotte O, Koen E, Poinssot B, Alcaraz G, Wendehenne D, Jeandroz S. Nitric oxide production mediates oligogalacturonide-triggered immunity and resistance to Botrytis cinerea in Arabidopsis thaliana. Plant Cell Environ. 2012 Aug;35(8):1483-99.
REFERENCE 2 Fernández-Pérez F, Vivar T, Pomar F, Pedreño MA, Novo-Uzal E. Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana. J Plant Physiol. 2015 Mar 1;175:86-94.
.
Protein ref. UniProtKB:   Q9LE15
DNA ref. Phytozome 12:   Chr1 (4975600..4974233)
mRNA ref. GenBank:   NM_101321.3
Cluster/Prediction ref. Phytozome Gene 12:   19655290 UniGene:   At.41966
Omic ref. AtProteome:   At1g14540 ATTED-II:   At1g14540 e-FP Browser:   At1g14540 ePlant:   At1g14540 Genevestigator:   At1g14540 TAIR:   At1g14540
Protein sequence: AtPrx04(At1g14540 / PER4 / AtP46)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (296)
PWM (Da):   %s   34275.09 (32181.0)  
PI (pH):   %s   7.87 (7.68) Peptide Signal:   %s   cut: 20 range:20-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIFKILVLLLSLCCFSQAQLSPTFYDQTCQNALSTIRSSIRTAI
SRERRMAASLIRLHFHDCFVN
GCDASVMLVATPTMESERDSLANFQSARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYDVKVGRRDSTNAFRAIADRDLPNFRASLNDLSELFLRKGLNTRDLVALSG
AHTLGQAQCLTFKGRLYDNSSDIDAGFSSTRKRRCPVNGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLESDQVLFGTGASTDSIVTEYSRNPSRFASDFSAAMIKMGDIQTLTGSDGQ
IRRICSAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns), 7 ESTs
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST