Entry information : ZmAPx[P]03(Zm00001d022383 / GRMZM2G045039 / GRMZM2G323182)
Entry ID 8002
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2022-12-31 (Christophe Dunand)
Peroxidase information: ZmAPx[P]03(Zm00001d022383 / GRMZM2G045039 / GRMZM2G323182)
Name ZmAPx[P]03(Zm00001d022383 / GRMZM2G045039 / GRMZM2G323182)
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]03
start..stop
S start..stop
ZmAPx[P]06 260 6.47e-92 1..127 1..127
ZmAPx[P]05 260 6.47e-92 1..127 1..127
ZmAPx[P]04 260 6.47e-92 1..127 1..127
ZmAPx[P]07 258 3.33e-91 2..127 1..126
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8002' 'join(128561898..128561949,128562192..128562277,128562361..128562440,128562596..128562698,128562775..128562834)' Exons


exon

Literature and cross-references ZmAPx[P]03(Zm00001d022383 / GRMZM2G045039 / GRMZM2G323182)
Protein sequence: ZmAPx[P]03(Zm00001d022383 / GRMZM2G045039 / GRMZM2G323182)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   127 (334)
PWM (Da):   %s   14019.1 (36644.0)  
PI (pH):   %s   5.63 (9.26) Peptide Signal:   %s   cut: 27 range:27-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QDKPQPPPEGRLPDATKGSNHLRQVFGKQMGLSDQDIVALSGGHTGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYADEKAFFDDYKEAHLKLSELG

Retrieve as FASTA  
Remarks Pseudogene (chromo 7). Large 5' end and last exon are missing.
DNA
Send to BLAST
CDS
Send to BLAST