1. Browse the Database
  2. View Redoxidase
Entry information : EgrPrx123 (Eucgr.H01218 / Egrandis_v1_0.023465m)
Entry ID 8128
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-09 (Qiang Li)
Peroxidase information: EgrPrx123 (Eucgr.H01218 / Egrandis_v1_0.023465m)
Name (synonym) EgrPrx123 (Eucgr.H01218 / Egrandis_v1_0.023465m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx123
start..stop		 S start..stop
EglPrx123 665 0 1..329 1..329
EcamPrx123 662 0 1..329 1..329
EguPrx123 661 0 2..329 1..328
CmicPrx01 471 6.13e-169 9..329 5..324
Gene structure Fichier Exons►


exon

Literature and cross-references EgrPrx123 (Eucgr.H01218 / Egrandis_v1_0.023465m)
DNA ref. Phytozome 12:   scaffold_8 (14646147..14643307)
Protein sequence: EgrPrx123 (Eucgr.H01218 / Egrandis_v1_0.023465m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (301)
PWM (Da):   %s   36130.64 (33021.1) Transmb domain:   %s   i9-31o
PI (pH):   %s   10.09 (10.18) Peptide Signal:   %s   cut: 29 range:29-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMVMRSDRHSLILGCVLGFLVLLGGCHGGSLKKNFYSKSCPLAEEIVRNVTWRHVAANITLPAKFLRMHFHDCFVRGCDGSVLLNSTKNNTAEKEAIPNLTLAGFDVIDDIKAEVEKKCP
GVVSCADILALAARDSVSFQFKRSTWKVLTGRRDGTVSLASEALANIPSPFLNFTALQQNFANKGLSVRDLVVLSGAHTIGVGHCNAFSVRLYNFSGKGDQDPSLNSTYAASLKNQCKNL
TDNTTFVPMDPITPLSFDTRYFTVLRQRRGLFESDAALLTNPNSASITREMLNSRRFFKSFRTSIKRMGAISVLTGKSGEIRKVCSKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (large part of exon 1 is missing).
DNA ►
Send to BLAST
CDS►
Send to BLAST