Entry information : EgrPrx129 (Eucgr.H03910 / Egrandis_v1_0.051276m)
Entry ID 8138
Creation 2011-02-09 (Qiang Li)
Last sequence changes 2011-02-22 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-09 (Qiang Li)
Peroxidase information: EgrPrx129 (Eucgr.H03910 / Egrandis_v1_0.051276m)
Name (synonym) EgrPrx129 (Eucgr.H03910 / Egrandis_v1_0.051276m)
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx129
start..stop
S start..stop
EcamPrx129-2 654 0 1..323 1..323
EcamPrx130 650 0 1..323 1..323
EgrPrx130 649 0 1..324 1..324
EglPrx130 649 0 1..323 1..323
Gene structure Fichier Exons


exon

Literature and cross-references EgrPrx129 (Eucgr.H03910 / Egrandis_v1_0.051276m)
DNA ref. Phytozome 12:   scaffold_8 (56858176..56856248)
Protein sequence: EgrPrx129 (Eucgr.H03910 / Egrandis_v1_0.051276m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   34745.68 (32378.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.08 (9.23) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEAQCPNTVSCA
DIVAFAARDGVRAAGGLHYAVPSGRRDGRVSLASEVIQNLPGAFFDAAQLKANFAKKGLSLRNMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNSPTDPIV
PFDPVTPNVLDNAYYRNLKSDKGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRMGSIEVLTGTQGEIRKNCRVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.(Egrandis_v1_0.051276m, scaffold_8: 56856248 - 56857992). Incorrect prediction from phytozome (Part of exon 1 is missing which has been completed manually). Intron 1.
DNA
Send to BLAST
CDS
Send to BLAST