Entry information : EgrPrx[P]142
Entry ID 8156
Creation 2011-02-25 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EgrPrx[P]142
Name EgrPrx[P]142
Class Class III peroxidase     [Orthogroup: Prx014]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]142
start..stop
S start..stop
EguPrx[P]142 274 9.57e-97 1..151 1..151
EcamPrx[P]142 240 1.13e-81 1..151 24..188
EgrPrx144 234 1.46e-78 1..151 26..183
EguPrx144 229 1.17e-76 1..151 26..183
Gene structure Fichier Exons


exon

Literature and cross-references EgrPrx[P]142
DNA ref. Phytozome 12:   scaffold_9 (38217451..38216853)
Protein sequence: EgrPrx[P]142
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   149
PWM (Da):   %s   16100.04 Transmb domain:   %s   o340-359i480-502o522-544i704-721o
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCHAQLSSTFYDESCPNALTAIRTSIRIAVLRKRQMAASLIQLHFHNCFV*GCDESILLDNSTTNSSERDAP*NRGSVRGYEVIDYAKSESVSCVDIVAVATQDASVAVGGPSWMVKLG
RRDTTTARPSLASSDLPLFREGLEKPVPKFA

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' and 3' ends are missing; Stops in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
CDS
Send to BLAST