1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx08 (At1g34510 / PER8)
Entry ID 84
Creation 2006-01-26 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtPrx08 (At1g34510 / PER8)
Name (synonym) AtPrx08 (At1g34510 / PER8)
Class Class III peroxidase     [Orthogroup: Prx025]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Roots
Inducers Hormon treatment
Stress treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx08
start..stop		 S start..stop
AtPrx[P]08 448 2.12e-160 1..305 1..308
BrPrx44-2Ab_other 440 2.94e-157 1..310 1..310
CagraPrx21 437 4.07e-156 1..310 1..310
AlyPrx44-1 437 6.51e-156 1..310 1..310
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx08 (At1g34510 / PER8)
Protein ref. UniProtKB:   Q9LNL0
DNA ref. Phytozome 12:   Chr1 (12616952..12615928)
mRNA ref. GenBank:   NM_103173
Cluster/Prediction ref. Phytozome Gene 12:   19656811 UniGene:   At.39717
Omic ref. ePlant:   At1g34510 TAIR:   At1g34510
Protein sequence: AtPrx08 (At1g34510 / PER8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310 (290)
PWM (Da):   %s   34195.55 (31862.4)  
PI (pH):   %s   9.54 (9.56) Peptide Signal:   %s   cut: 21 range:21-310
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAIAAWFFIFCYLVPSVFAQLRHGFYEGTCPPAESIVGRVVFNH
WDRNRTVTAALLRMQFHDCVVKGCDASLLIDPTTERPSEKSVGRNAGVRGFEIIDEAKKELELVCPKTVSCADIVTIATRDSIALAGGPKFKVRTGRRDGLRSNPSDVKLLGPTVSVATSIKAFKSIGFNVSTMVALIGGGH
TVGVAHCSLFQDRIKDPKMDSKLRAKLKKSCRGPNDPSVFMDQNTPFRVDNEIYRQMIQQRAILRIDDNLIRDGSTRSIVSDFAYNNKLFKESFAEAMQKMGEIGVLTGDSGEIRTNCRA
FNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1), 2 cDNA and 6 ESTs (5 from roots only).
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST