1. Browse the Database
  2. View Redoxidase
Entry information : SbPrx108 (Sobic.009G032600.1 [2.1] / Sb09g002740 [1.4])
Entry ID 849
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2006-01-18 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx108 (Sobic.009G032600.1 [2.1] / Sb09g002740 [1.4])
Name (synonym) SbPrx108 (Sobic.009G032600.1 [2.1] / Sb09g002740 [1.4])
Class Class III peroxidase    [Orthogroup: Prx109]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducers Dark growth
Light growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx108
start..stop		 S start..stop
SofPrx12 633 0 24..341 22..340
ZmPrx104 607 0 20..341 22..352
SiPrx91 603 0 24..341 25..342
ZmPrx[P]75 583 0 9..341 1..336
Gene structure Fichier Exons►


exon

Literature and cross-references SbPrx108 (Sobic.009G032600.1 [2.1] / Sb09g002740 [1.4])
Literature Klein,R.R. et al., unpublished
DNA ref. Phytozome 12:   chromosome_9 (2981199..2985963)
EST ref. GenBank:   BG948833 [5' end]  BG048478 [3' end]
Cluster/Prediction ref. UniGene:   Sbi.11039
Protein sequence: SbPrx108 (Sobic.009G032600.1 [2.1] / Sb09g002740 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (316)
PWM (Da):   %s   36776.16 (34383.8) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.78 (8.88) Peptide Signal:   %s   cut: 26 range:26-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVSALCAAAVLLLLVAQAPSAAEASHLKLGYYKKTCPGVEKIVK
YHVAKAIKANRAAGAALVRLIFHDCFVRGCDGSVLLDPTPANPKTEKTAPVNIGLAAFDVIDDIKAALESHCPGTVSCADIVIYAARDASSLLSNGHVHFAAPAGRLDGVISRAADAQRDLPDSTFTISELIRNFRRKNFTVEELVIL
SGAHAIGVGHCSSFRARLSSPPSQIVPAYRNLLSAKCAAGPDPVVTNNVRDEDPRAVAASFPSFLKKLRKAKDFLDNSYYHNNLARIVTFNSDWQLLTEKEALGHVKEYAENGTLWDEDF
SDALVKLSKLPMPPHSKGEIRKSCRWVN*

Retrieve as FASTA  
Remarks Complete sequence from ESTs and genomic (GSS, intron 1).
DNA ►
Send to BLAST
CDS►
Send to BLAST