Entry information : Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Entry ID 859
Creation 2008-10-22 (Christophe Dunand)
Last sequence changes 2011-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Name (synonym) Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Callus
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sb1CysPrx01
start..stop
S start..stop
Zm1CysPrx 421 3e-152 1..222 1..229
Hv1CysPrx 384 9.07e-138 1..222 1..218
Ta1CysPrx01-2D 381 6.18e-137 1..222 1..218
Asp1CysPrx01-B 380 1.69e-136 1..222 1..218
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '859' 'join(74565231..74565348,74565437..74565987)' Exons


exon

Literature and cross-references Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_2 (74565231..74565987)
Cluster/Prediction ref. UniGene:   Sbi.3724
Protein sequence: Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222 (342)
PWM (Da):   %s   24070.19 (36628.4) Transmb domain:   %s   i12-30o
PI (pH):   %s   6.4 (5.87) Peptide Signal:   %s   cut: 24 range:24-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTVPNLELDSTHGKIRIHDYVGDGYAIIFSHPADFTPVCTTEMAAMAGYAKEFEKRGVKLLGISCDDVESHREWTKDIEAYGGGKQKVTYPILADPGRDAIRQLNMVDPDEKDSNGVSLPSRALHVVGPDKAVKLSFLYPATTGRNMDEVLR
AVDSLLTAAKHGGKVATPANWKPGDRAVIAPSVSDEEARKMFPHGFETADLPSKKSYLRFTKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 1 intron) and 18 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST