1. Browse the Database
  2. View Redoxidase
Entry information : CclPrx83 (clementine0.9_027614m)
Entry ID 8714
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx83 (clementine0.9_027614m)
Name (synonym) CclPrx83 (clementine0.9_027614m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx83
start..stop		 S start..stop
CsPrx46 657 0 1..324 1..324
MePrx88 516 0 7..323 2..319
CclPrx46 513 0 1..323 1..322
CsPrx47 508 0 1..324 1..324
Gene structure Fichier Exons►


exon

Literature and cross-references CclPrx83 (clementine0.9_027614m)
DNA ref. Phytozome 12:   scaffold_7 (4258880..4251850)
Protein sequence: CclPrx83 (clementine0.9_027614m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (297)
PWM (Da):   %s   35187.7 (32512.2)  
PI (pH):   %s   7.05 (6.51) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGSLSFFLISLVALLLGACRGGGLGKSFYKETCPEAEDIVQKIIWKNVALNSTLPAKFLRMHFHDCFVRGCDASILIDSTASNSAEKDSIPNQTVGGFDVIEEVKTELEKKCPGIVSCA
DIVALAARDSVSFQFEKPLWEVLTGRRDGRISLVSEANSQIPAPSFNFSRLKQSFASKGLTVHDLVVLSGGHTIGVGHCNFFSRRLYNFTGKGDADPSLDSTYAAFLRTKCRSLADNTTI
VEMDPGSGMYFDNNYHKILRQNKGMFQSDAALLTDNGASNIVDELLDPAKFFTEFAQSMERMGAVGVLTGTSGEIRKKCNVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST