1. Browse the Database
  2. View Redoxidase
Entry information : CsaPrx24 (Cucsa.087760.1)
Entry ID 8814
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-11 (Achraf Jemmat)
Peroxidase information: CsaPrx24 (Cucsa.087760.1)
Name (synonym) CsaPrx24 (Cucsa.087760.1)
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx24
start..stop		 S start..stop
VvPrx65 486 5.28e-175 11..326 7..322
NnPrx59 479 4.29e-172 6..326 5..325
HaPrx08 479 6.51e-172 1..326 1..326
MePrx64 476 6.17e-171 4..326 1..323
Gene structure Fichier Exons►


exon

Literature and cross-references CsaPrx24 (Cucsa.087760.1)
DNA ref. Phytozome 12:   scaffold00888 (310947..313394)
Protein sequence: CsaPrx24 (Cucsa.087760.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   34855.45 (32190.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.68 (7.31) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGMAMRVAVLSLALLCMLIGVVHAQLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRLFFHDCFVQGCDASVMIASASGDAEKDSEDNLSLAGDGFDTVIKAKQAVEAQCPGKV
SCADILAIAARDVVVLAGGQNFAVELGRRDGLISKASLVAGNLPGPNFNLSQLNTMFAKNNLTQTNMIALSGAHTVGFSHCSRFANRLYNFSATSKVDPSLDPKYAKQLMGACPQDVDPR
IAVNMDPVTPRKMDNVYYQNLVNHKGLFTSDQVLYTDPLSQATVSGFANDRSGFNKAFGEAMVQLGRVGVKTGAAGEIRKDCTAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA ►
Send to BLAST
CDS►
Send to BLAST