1. Browse the Database
  2. View Redoxidase
Entry information : CsaPrx77 (Cucsa.284220.1)
Entry ID 8850
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx77 (Cucsa.284220.1)
Name (synonym) CsaPrx77 (Cucsa.284220.1)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx77
start..stop		 S start..stop
PpePrx72 525 0 12..341 15..340
MePrx12 525 0 3..341 7..340
VvPrx48 519 0 27..341 27..339
MePrx128 516 0 25..341 28..342
Gene structure Fichier Exons►


exon

Literature and cross-references CsaPrx77 (Cucsa.284220.1)
DNA ref. Phytozome 12:   scaffold02653 (1064739..1061753)
Protein sequence: CsaPrx77 (Cucsa.284220.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341
PWM (Da):   %s   37629.83 Transmb domain:   %s   i7-26o
PI (pH):   %s   5.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGISNKVYGVVMMIVFCGLFVVSYSLFETGETRLTLDYYTRTCPNVLQIVRKEMECAVLSEPRNAAFVVRLHFHDCFVQGCDGSVLLDDTITLQGEKKASNNIHSLKGFRIIDRIKNSIE
SECPGIVSCADILTIAARDAVILVGGPYWDVPLGRKDSTSASYELANTNLPSANEGLLSIISKFLYQGLSVTDMVALSGAHTIGMARCKNFRQRIYGDFDATSDPNNPISGSYIEKLRSI
CPLVGKTGEDNITAMDNMTPELFDNSYFHILMRGEGVLNSDQELYSSLLGIETKALVKKYAADPIAFFQQFSDSMVKLGNITNSDSFVNGEVRKNCRFINT*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST