1. Browse the Database
  2. View Redoxidase
Entry information : CsPrx52 (orange1.1g018796m/orange1.1t02040)
Entry ID 8894
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx52 (orange1.1g018796m/orange1.1t02040)
Name (synonym) CsPrx52 (orange1.1g018796m/orange1.1t02040)
Class Class III peroxidase    [Orthogroup: Prx100]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx52
start..stop		 S start..stop
CclPrx05 704 0 1..350 1..350
CsPrx61 686 0 1..350 1..350
CclPrx68 661 0 1..350 1..349
CsPrx54 659 0 1..351 1..350
Gene structure Fichier Exons►


exon

Literature and cross-references CsPrx52 (orange1.1g018796m/orange1.1t02040)
DNA ref. Citrus sinensis Annotation Project:   chrUn (32206807..32209717) Phytozome 12:   scaffold00043 (12053..14553)
Protein sequence: CsPrx52 (orange1.1g018796m/orange1.1t02040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   37925 (35164.5)  
PI (pH):   %s   6.5 (6.50) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLRFLLAAALVVAFVLEGSSPAQAQLSPSFYNSTCPNVANIIREVLQNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTTTIVSEKFAAPNNNSARGFEVVDDMKAAVERACPGV
VSCADILTIAAEQSVALSGGPSWTNLLGRRDSRTANRTLANENLPGPNNSLERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNSTGNPDPTLNTTLLQQLRQLCPQGGN
GSVLTNLDVTTPDVFDNKYFFNLQIHKGLLQSDQELFSTPGADTAAIVNNFGRNQTAFFENFVTSMIRMGNLKPLTGNQGEIRLNCRRVNGNSNIATRSSSSEGDLVSSF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST