1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx131 (Glyma03g04740.1)
Entry ID 8951
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx131 (Glyma03g04740.1)
Name (synonym) GmPrx131 (Glyma03g04740.1)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx131
start..stop		 S start..stop
GmPrx130 649 0 1..319 1..319
GmPrx128 648 0 1..320 1..320
GmPrx129 646 0 1..320 1..320
GmPrx97 614 0 1..320 1..320
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx131 (Glyma03g04740.1)
DNA ref. Phytozome 12:   Gm03 (4944150..4942002)
Protein sequence: GmPrx131 (Glyma03g04740.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   34651.06 (31863.6) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.92 (4.73) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRGYFFVVLHALVFASIATSAFSQLSPNYYDYSCPSALSTIKSVVEASVQKERRIGASLLRLHFHDCFVNGCDGSILLDSTSSIDSEKNAAANLQSARGFEVVDDIKKAVDEACGKAV
VSCADILAVAARDSVVALGGPSWKVRLGRRDSTTASREAADASIPAPFFSLSELITNFKNHGLDEKDLVVLSGGHSIGFARCVTFKDHIYNDSNIDPNFAQQLRYICPTNGGDSNLSPLD
STAAKFDINYYSNLVQKKGLLHSDQELFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRNVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST