Entry information : GmPrx183 (Glyma09g07550.1)
Entry ID 8975
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx183 (Glyma09g07550.1)
Name (synonym) GmPrx183 (Glyma09g07550.1)
Class Class III peroxidase    [Orthogroup: Prx303]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx183
start..stop
S start..stop
LjPrx47 517 0 12..327 1..315
MtPrx27 498 1.24e-179 1..327 1..331
LjPrx26 485 3.43e-174 9..327 15..332
GmPrx235 479 8.23e-172 4..327 7..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8975' 'join(6457194..6457403,6457811..6457996,6458123..6458288,6458956..6459376)' Exons


exon

Literature and cross-references GmPrx183 (Glyma09g07550.1)
DNA ref. Phytozome 12:   Gm09 (6457194..6459376)
EST ref. GenBank:   FK022928.1
Protein sequence: GmPrx183 (Glyma09g07550.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   36055.92 (33416.6)  
PI (pH):   %s   4.91 (4.71) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNRSSNANFWLVNFFILSVGVRSQLTPDFYKTTCPDLYRIVRREVQKALKYEMRMGASLLRLHFHDCFVNGCDGSILLDGDQDSEKFATPNLNSARGFEVIDTIKSSVERACSGAVSCAD
ILAIAARDSVLLSGGPFWYVQLGRRDGLISNGTLANLAIPSPFDTLDTIISKFNDVGLDLKDVVTLSGAHTTGRARCTFFSNRLFNSSGTEAPDSTIETTMLTExLQNLCLQNGDENTTS
VLDQGSVNLFDNHYFKNLLDWKGLLSSDQILFSSDNATETTKPLVQSYSVNERIFFMEFAYAMIKMGNINPLTDSEGEIRKNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Incorrect prediction from Phytozome (3' end is missing due to frame shift=> extra ta: sequencing error or pseudogene?.
DNA
Send to BLAST
CDS
Send to BLAST