1. Browse the Database
  2. View Redoxidase
Entry information : MguPrx101 (mgv1a025866m)
Entry ID 9176
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx101 (mgv1a025866m)
Name (synonym) MguPrx101 (mgv1a025866m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx101
start..stop		 S start..stop
MguPrx73 578 0 1..324 4..314
KfedPrx38 442 2.94e-157 23..324 26..327
PpePrx78 429 1.93e-152 5..324 7..322
StPrx20 427 1.02e-151 3..324 8..322
Gene structure Fichier Exons►


exon

Literature and cross-references MguPrx101 (mgv1a025866m)
DNA ref. Phytozome 12:   scaffold_92 (799087..796628)
Protein sequence: MguPrx101 (mgv1a025866m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34608.1 (32058.7) Transmb domain:   %s   o10-32i
PI (pH):   %s   4.37 (4.30) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVPIATFLVLIFVTVFEKGCNAQLSTTFYATTCPNISSVVLNVI
QQAQRADVRAAPKLIRLHFHDCFVDGCDGSLLLDNADGILSEKDAFPNAGSVDGFGIVDNMKTALESVCPGVVSCADILALASQISVNLVGGPSYSVPLGRRDGRTANRAGANTELPSPFANLDELRSNFSAKGLDSTDLVALSG
AHTFGRAKCNTFSHRLYNFANSGGPDQTIEPTYLETLRQTCPQNGAGTTLENLDQSTPDEFDNEYFENLQSGKGLLQTDQLLFSSTGSDTVAIVDRFGDSETEFFDAFVRSIIKMGNIAP
LTGTQGEIRADCK

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA ►
Send to BLAST
CDS►
Send to BLAST