1. Browse the Database
  2. View Redoxidase
Entry information : MguPrx79 (mgv1a019717m)
Entry ID 9238
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx79 (mgv1a019717m)
Name (synonym) MguPrx79 (mgv1a019717m)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx79
start..stop		 S start..stop
NtPrx63-1B 415 4.13e-145 1..348 1..413
NtPrx63-1A 414 1.14e-144 1..348 1..413
VvPrx95 395 5.5e-138 5..348 11..366
LePrx106 396 1.12e-137 1..348 1..413
Gene structure Fichier Exons►


exon

Literature and cross-references MguPrx79 (mgv1a019717m)
DNA ref. Phytozome 12:   scaffold_7 (1746477..1749079)
Protein sequence: MguPrx79 (mgv1a019717m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (323)
PWM (Da):   %s   38637.48 (35728.8)  
PI (pH):   %s   5.68 (4.98) Peptide Signal:   %s   cut: 26 range:26-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDFTRKLSFVVFILCVLISLKKKQADINRRGCVASDSPPPLQAPP
SHRKLQQNDGGENVLPEGIRYDYYNESCPSAEQIIRSTVQELYEFRPDVAPALLRLAFHDCFVKGCDASILLDPTNSTASEKEAFPNQSLRGFDVIDIIKSEVEEACPGVVSCADIVVLAARESVLVAGGPFYPLLTGRKDNKEGSLDEANRLPSPQDHLYETLHKFQPKGFTERETITLLGAH
SVGTIHCSFFNERLFNFKGSNAPDPSIDADSSQNPGMKMDYEGPRKDFGTLYYRSLLQRKGLLFVDQQLTSMAEAQVWVQAYASDLSLFKRDFGLAMMKLSNLHLLNASVGEVRLNCR

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST