Entry information : RcPrx58 (30054.m000791)
Entry ID 9381
Creation 2011-06-30 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx58 (30054.m000791)
Name (synonym) RcPrx58 (30054.m000791)
Class Class III peroxidase     [Orthogroup: Prx041]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx58
start..stop
S start..stop
PtPrx83 345 3.47e-121 7..201 144..338
PpePrx23 337 4.13e-118 7..200 136..332
VvPrx15 328 1.26e-114 7..200 138..331
CpapPrx51 318 2.6e-110 7..201 139..335
Gene structure Fichier Exons


exon

Literature and cross-references RcPrx58 (30054.m000791)
DNA ref. Phytozome 12:   30054 (43678..45108)
Protein sequence: RcPrx58 (30054.m000791)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201
PWM (Da):   %s   22708.48  
PI (pH):   %s   9.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFMKKRGGPIWDVWLGRKDSLKASFDGANKFIPSPNSSLETLIANFKQQGLDIGDLVALSGSHTMGKARCLSFRQRAYNVNPEENYDKYKRYTTYRRILRSICPRSGKDNELAPLDYKT
PARFDNQYFLNILEGRGLLGSDNVLVSEDDEGDIIRQVWAYASDQELFFGSFVNSIIKMGNINVLTANEGEIRKNCRFVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing). 1 EST.
DNA
Send to BLAST
CDS
Send to BLAST