1. Browse the Database
  2. View Redoxidase
Entry information : NcGPx01
Entry ID 9836
Creation 2011-11-22 (Passaia Gisèle)
Last sequence changes 2012-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: NcGPx01
Name NcGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcGPx01
start..stop		 S start..stop
NtetGPx01_2509 465 8.38e-170 1..229 1..227
SmaGPx01 377 5.18e-135 1..229 1..224
NdisGPx01 340 4.31e-121 63..229 1..167
StheGPx01 295 2.12e-102 43..229 51..237
Gene structure Fichier Exons►


exon

Literature and cross-references NcGPx01
Literature Hammond TM et al. Fine-scale mapping in Neurospora crassa by using genome-wide knockout strains. Mycologia. 2011 Nov 8.
Protein ref. UniProtKB:   Q7S060 [Incorrect prediction]
DNA ref. JGI genome:   supercont10.5 (4499782..4499011)
EST ref. GenBank:   AI392289
Protein sequence: NcGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   25871.5 Transmb domain:   %s   i7-29o
PI (pH):   %s   9.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPRYHHRSVATLARTSLTTRHLKLSPILPQQQQQQPRLPVSKPAFRCQPAISRRFATTTLNMSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEK
YPDDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKNEKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELG

Retrieve as FASTA  
Remarks Complete sequence from genomic (supercontig 10, 1 intron) and 1 EST (bad quality). Strain="ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987" and "OR74A".
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST