1. Browse the Database
  2. View Redoxidase
Entry information : TatGPx01
Entry ID 9840
Creation 2011-11-23 (Passaia Gisèle)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: TatGPx01
Name TatGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Hypocreaceae Trichoderma
Organism Trichoderma atroviride    [TaxId: 63577 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value TatGPx01
start..stop		 S start..stop
TaspGPx01 455 1.71e-164 1..264 1..265
TviGPx01 372 7.49e-132 5..262 5..255
TharGPx01 316 4.87e-111 93..262 1..170
HjGPx01 313 1.18e-108 90..262 91..263
Gene structure Fichier Exons►


exon

Literature and cross-references TatGPx01
DNA ref. JGI genome:   contig_27 (4075760..4074851)
EST ref. GenBank:   GE291060.1 [5' end]  GE296600.1 [3' end]
Protein sequence: TatGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   264
PWM (Da):   %s   29923.54  
PI (pH):   %s   9.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPPVHSKFPGAVLALGPNLRGLKLRRDASRFEALSRVPPLVAKRHRWNDFVRSRRFIYCAAAQPGETPTLHHRHCIPRLDTSLHRRLYSSAMASATNFFEFKALDATDNEIPLSNFKGK
VVLVVNTASKCGFTYQYKNLESVYQEIKKEYPDDFTIIGFPCNQFGGQEPGSNEEIQNFCSLDQKVTFPVLGKINVNGDDAHPLYKWLKHEKPGLLGLERVKWNFEKFLIGRNGKVVDRW
ASTTEPEKFQGRILEEIKKPAPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) and 9 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST