Entry information : AcoPrx[P]116
Entry ID 9995
Creation 2011-12-14 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx[P]116
Name AcoPrx[P]116
Class Class III peroxidase     [Orthogroup: Prx081]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]116
start..stop
S start..stop
AcoPrx51 434 5.31e-155 1..270 1..325
AcoPrx101 383 3.05e-135 12..253 5..301
AcoPrx63 341 1.25e-118 1..269 1..325
AfpPrx23 337 1.09e-116 1..269 1..326
Gene structure Fichier Exons


exon

Literature and cross-references AcoPrx[P]116
DNA ref. Phytozome 12:   scaffold_2 (1574820..1575897)
Protein sequence: AcoPrx[P]116
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   270 (240)
PWM (Da):   %s   29577.82 (26212.1) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.42 (6.66) Peptide Signal:   %s   cut: 31 range:31-270
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTPSNCSKQYSKFFVLIVFFTTITTPVLAQLSAGLASTCPSVLDTVRSATRSAINREARIVVWAHLFFHGCFVNGCDGGVLLDDTTSVPGEETVLPNLGSARGFEVIDAIKTQVDRACC
GSEVSGLPGFLENLGPLLSKFSAKGFSAREMVALSGAHTVGQARWVVYRNRIYNKTNIDPAYAISLQAPLDPHSPNRFGNNYFQALINRRTILHSDQELFNGGSTDSIVRDYNDNPATFS
TDFANAMVKMGDIIYQSFIDWYPRRDSKRL

Retrieve as FASTA  
Remarks Pseudogene from genomic (Gaps in frame). No prediction from phytozome.
DNA
Send to BLAST