1. Browse the Database
  2. View Redoxidase
Entry information : CnPrxQ_grubiiH99
Entry ID 11053
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: CnPrxQ_grubiiH99
Name CnPrxQ_grubiiH99
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnPrxQ_grubiiH99
start..stop		 S start..stop
CnPrxQ_JEC21 303 1.39e-107 1..167 1..167
LbiPrxQ02 165 2.6e-52 11..162 69..222
PcPrxQ02 163 1.11e-51 22..153 88..217
AthiPrxQ 160 3.51e-50 22..162 104..242
Gene structure Fichier Exons►


exon

Literature and cross-references CnPrxQ_grubiiH99
DNA ref. JGI genome:   cneoH99_Chr3 (608736..607959)
Protein sequence: CnPrxQ_grubiiH99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167 (319)
PWM (Da):   %s   18709.46 (34094.2) Transmb domain:   %s   o337-356i477-499o519-541i701-718o
PI (pH):   %s   5.11 (6.39) Peptide Signal:   %s   cut: 23 range:23-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPHEDNEEHEDEEDGEVLKKGDRLPSIKLKDEEGNTVDVSTLAGEKGVVFFLYPKADTPGCTNQACGYRDMFDEIAVFGYEVYGLSKDTPTAQQKWKAKKSLNYHLLSDPKSKLIKRLG
AFVPPKNTKRSHFIFEKGTGNLIDIDIGVRPAEDPNNVLGFLTEKYL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Strain="H99", variety="grubii".
DNA ►
Send to BLAST
CDS►
Send to BLAST