1. Browse the Database
  2. View Redoxidase
Entry information : EguPrx71
Entry ID 11530
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EguPrx71
Name EguPrx71
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx71
start..stop		 S start..stop
EglPrx71 663 0 1..327 1..327
EgrPrx71 660 0 1..327 1..327
EcamPrx71 656 0 1..327 1..327
EguPrx72 593 0 1..327 1..327
Gene structure Fichier Exons►


exon

Literature and cross-references EguPrx71
Protein sequence: EguPrx71
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35557.55 (32552.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.53 (8.70) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLLLSCLLLQLMFFFLVPEVAQGHGLKVGFYQKACPNAEAIVKEVIGQVLSIDPSLSGPILRLHFHDCFVRGCEGSVLLESPTYQSEKYAIRKLGLRGYQEIDRVKTALEKACPGI
VSCADILALVNRDIVVATGGLFYDVETGRRDGYVSILEEALRDLIPPSTNITTLKADFAKRGLSAKDLVVLSGGHTIGNSHCAAFSNRLYNFTGKGDADPTLDSNYIARLKxSCKPNDQT
TLVEMDPGSARTFDIKYFDLILKRRGLFTSDAALLDDKQTKAYLDFQIKTGGSTFFKDFGVSMVKMGRVGVLTKTAGEVRKVCTKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_3_9974 (3960..6084)
DNA ►
Send to BLAST
CDS►
Send to BLAST