1. Browse the Database
  2. View Redoxidase
Entry information : EgrPrx71
Entry ID 8166
Creation 2011-03-01 (Christophe Dunand)
Last sequence changes 2011-03-01 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-02-15 (Qiang Li)
Peroxidase information: EgrPrx71
Name EgrPrx71
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx71
start..stop		 S start..stop
EglPrx71 664 0 1..327 1..327
EcamPrx71 663 0 1..327 1..327
EguPrx71 660 0 1..327 1..327
EguPrx72 599 0 1..327 1..327
Gene structure Fichier Exons►


exon

Literature and cross-references EgrPrx71
DNA ref. Phytozome 12:   scaffold_3 (52638072..52640199)
Protein sequence: EgrPrx71
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35714.68 (32709.1)  
PI (pH):   %s   8.67 (8.86) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLLLSCLLLQLMFFFLVPEVAQGHGLKVGFYQKACPNAEAI
VKEVIGQVLSIDPSLSGPILRLHFHDCFVRGCEGSVLLESPTYQSEKYAIRKLGLRGYQEIDRVKTALEKACPGIVSCADILALVTRDIVVATGGLFYDVETGRRDGYVSILEEARRDLIPPSTNITTLKADFAKRGLSAKDLVVLSGGH
TIGNSHCAAFSNRLYNFTGKGDADPTLDSNYIARLKLSCKPNDQTTLVEMDPGSARTFDIKYFDLILKRRGLFTSDAALLDDKQTKAYLDFQIKTGGSTFFKDFGVSMVKMGRIGVLTKT
AGEVRKVCTKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo3, 3 introns). No prediction from Phytozome.
DNA ►
Send to BLAST
CDS►
Send to BLAST