Entry information : Amus2CysPrx
Entry ID 11673
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: Amus2CysPrx
Name Amus2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Amus2CysPrx
start..stop
S start..stop
Athi2CysPrx01 348 7.7e-124 1..215 1..216
Ccin2CysPrx 345 1.51e-122 1..215 1..210
Pc2CysPrx01-1 343 9.42e-122 1..214 1..209
Pcar2CysPrx01-1 340 1.65e-120 1..215 1..210
Gene structure Fichier Exons


exon

Literature and cross-references Amus2CysPrx
DNA ref. JGI genome:   scaffold_140 (67721..68688)
Cluster/Prediction ref. JGI gene:   376098
Protein sequence: Amus2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   23993.24  
PI (pH):   %s   5.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSALIQRPAPSFTATAVIEGQFKEVSLSDYQGQWVVLFFYPMDFTFVCPTEILAFNDSLAKFKELNTVVLGASTDSEYSHFAWANQPRKEGGIGPNLSLPLIADKNMEISRKYGVLLEDK
GIALRGSFLIDPKGILRQITVNDLPVGRSVDETIRLIKAFQFTDKNGDVCPVNWTEGSKTIKADPIASHEYFSSVNANGIDHDMEDGSAKKRPRTGK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
CDS
Send to BLAST