Entry information : LuPrx150(Lus10027988|PACid:23181165)
Entry ID 12098
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx150(Lus10027988|PACid:23181165)
Name LuPrx150(Lus10027988|PACid:23181165)
Class Class III peroxidase     [Orthogroup: Prx104]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx150
start..stop
S start..stop
LuPrx43 360 9.04e-127 7..206 144..343
LuPrx151 287 8.74e-98 11..206 153..351
LuPrx149 286 1.26e-97 11..206 149..345
LuPrx42 286 3.74e-97 11..206 165..363
Gene structure Fichier Exons


exon

Literature and cross-references LuPrx150(Lus10027988|PACid:23181165)
DNA ref. Phytozome 12:   scaffold132 (204160..202505)
Protein sequence: LuPrx150(Lus10027988|PACid:23181165)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   207 (302)
PWM (Da):   %s   21936.79 (32823.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.29 (8.57) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METGSSLTMLDSVAANRTLANSELPPPFFTVDQLKATFSAVGLNTTVDLVALSGAHTFGRAQCGSFINRLYNFNGTGSPDPTVNATYLQTLQQLCPQNGTATVLANLDRSTADGFDSTYF
ANLQTQEGPLDSDQALFSTPNSDTIALVNTFCVNRTAFFESFVNSMIRMGNILPPVGTSGEIRLNFRVINPAASGTAVITTPAGFVC*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing.
DNA
Send to BLAST
CDS
Send to BLAST