Entry information : DqueGPx01
Entry ID 12312
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: DqueGPx01
Name DqueGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Daedalea
Organism Daedalea quercina    [TaxId: 40437 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DqueGPx01
start..stop
S start..stop
FpinGPx01 303 1.21e-106 1..160 70..229
NlepGPx01 293 6.78e-103 3..160 60..217
WcoGPx01 288 5.58e-102 1..160 1..160
GtraGPx01 290 7.51e-102 1..160 62..221
Gene structure Fichier Exons


exon

Literature and cross-references DqueGPx01
Cluster/Prediction ref. JGI gene:   762393
Protein sequence: DqueGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   17758.1  
PI (pH):   %s   8.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSFYDLKAELPGGKTYDFAELKGKVVLIVNTASKCGFTPQYKGLQTLWDKYKDKDFVLLGFPCNQFGGQEPGSDEKIAEFCTLNHGVTFPLMKKSDVNGDNTNEVFKWLKGQKAGLLGM
TRIKWNFEKFLVDKEGKVVGRWASTTTPDAIDAEIAKLL*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
CDS
Send to BLAST