Entry information : SsteMnP08
Entry ID 12322
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP08
Name SsteMnP08
Class Manganese peroxidase     [Orthogroup: MnP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP08
start..stop
S start..stop
SsteMnP06 319 9.17e-114 1..160 1..160
RrubMnP05 265 4.29e-90 1..160 1..161
SsteMnP07 253 8.22e-88 1..160 1..158
RrubMnP01 253 4.78e-85 1..160 1..161
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12322' 'join(679999..680150,680201..680253,680308..680582)' Exons


exon

Literature and cross-references SsteMnP08
DNA ref. JGI genome:   scaffold_32 (679999..680582)
Cluster/Prediction ref. JGI gene:   165363
Protein sequence: SsteMnP08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160 (142)
PWM (Da):   %s   16623.29 (14636.2)  
PI (pH):   %s   5.06 (4.76) Peptide Signal:   %s   cut: 19 range:19-160
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLFAFVSLISFAAAAPPRLVACGDGNFASNSACCPLFALREDLQANLFDNECGEDTHEVVRLTFHDAVAFSTSLKRQGKAAGGGADGSMLIFPTVEPNFSANNGIIDSVDALTPFL
ASHPKISAGDLIQFAGAVGISNCPGAPRLQFLLGRPNATA*

Retrieve as FASTA  
Remarks incorrect sequence from genomics (2 introns)
DNA
Send to BLAST
CDS
Send to BLAST