Entry information : CsPrx07 (orange1.1g020951m/Cs1g20230)
Entry ID 1374
Creation 2007-03-23 (Christophe Dunand)
Last sequence changes 2011-07-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-11-30 (Qiang Li)
Peroxidase information: CsPrx07 (orange1.1g020951m/Cs1g20230)
Name (synonym) CsPrx07 (orange1.1g020951m/Cs1g20230)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Fruits
Shoot meristems
Whole plant
Inducer Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx07
start..stop
S start..stop
CclPrx48 653 0 1..319 1..319
CppPrx06 649 0 3..319 1..317
LcPrx01 523 0 1..319 1..317
GrPrx25 494 2.94e-178 9..320 17..329
Gene structure Fichier Exons


exon

Literature and cross-references CsPrx07 (orange1.1g020951m/Cs1g20230)
Literature Close,T.J., Roose,M.L., Federici,C.F., Mu,L., Fenton,R.D., Wanamaker,S., Kim,H.R., Kudrna,D., Wing,R. and Yu,Y. Development of EST Resources and New Genetic Markers for California Citrus - Washington Navel Orange Shoot Meristem.
DNA ref. Citrus sinensis Annotation Project:   chr1 (23341276..23343370) Phytozome 12:   scaffold00059 (300095..301766)
Cluster/Prediction ref. UniGene:   Csi.5407
Protein sequence: CsPrx07 (orange1.1g020951m/Cs1g20230)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (301)
PWM (Da):   %s   34606.82 (32473.7)  
PI (pH):   %s   10.13 (10.23) Peptide Signal:   %s   cut: 19 range:19-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATSYYFLLLILTFVTATLDQANSQLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVLLDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVV
SCADILAIAARDSVVVFGGPSWKVRLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDR
QTPTCFDNLYYKNLLNKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 11 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST