Entry information : CsPrx15 (orange1.1g020615m/Cs2g09310)
Entry ID 1376
Creation 2007-09-27 (Christophe Dunand)
Last sequence changes 2011-07-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx15 (orange1.1g020615m/Cs2g09310)
Name (synonym) CsPrx15 (orange1.1g020615m/Cs2g09310)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Shoot meristems
Whole seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx15
start..stop
S start..stop
CclPrx07 662 0 1..323 1..323
MePrx83 519 0 8..323 1..316
PpePrx20 513 0 6..324 7..326
NnPrx73 512 0 1..323 1..321
Gene structure Fichier Exons


exon

Literature and cross-references CsPrx15 (orange1.1g020615m/Cs2g09310)
Literature Bausher,M., et al., An expressed sequence tag (EST) set from Citrus sinensis L. Osbeck whole seedlings and the implications of further perennial source investigations Plant Sci. 165, 415-422 (2003).
DNA ref. Citrus sinensis Annotation Project:   chr2 (6628218..6631077) Phytozome 12:   scaffold00743 (14702..12209)
EST ref. GenBank:   CF835865 [5' end]
Protein sequence: CsPrx15 (orange1.1g020615m/Cs2g09310)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (297)
PWM (Da):   %s   34580.54 (31774.1)  
PI (pH):   %s   10.03 (9.93) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSFSSLMVTLALGFLVVFTGKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGV
VSCADILAIAARHSVAILGGPSWNVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCVAFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLA
PLDFQSPNKFDNQYYKHLLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRKNCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 3 ESTs (CK665074, CK936454). Cultivar ="Ridge Pineapple".
DNA
Send to BLAST
CDS
Send to BLAST