1. Browse the Database
  2. View Redoxidase
Entry information : PpePrx20 (ppa008607m)
Entry ID 9270
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx20 (ppa008607m)
Name (synonym) PpePrx20 (ppa008607m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx20
start..stop		 S start..stop
PpePrx19 614 0 1..326 1..327
CsPrx15 513 0 7..326 6..324
CclPrx07 512 0 7..325 6..323
GhPrx13 504 0 24..325 22..322
Gene structure Fichier Exons►


exon

Literature and cross-references PpePrx20 (ppa008607m)
DNA ref. Phytozome 12:   scaffold_6 (2008623..2011635)
Protein sequence: PpePrx20 (ppa008607m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (298)
PWM (Da):   %s   34724.55 (31914.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.65 (9.64) Peptide Signal:   %s   cut: 28 range:28-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGRSSSLCSIWVIVLLVGFTGSSSAQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPG
VVSCADILAIAARDSVKILGGPSWNVKLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQARCTSFRARIYNETNIDASFAKARQSKCPSTVGSGDNNL
APLDVQTPNTFDTAYFKNLINQKGLLHSDQILYNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEIRLNCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST