1. Browse the Database
  2. View Redoxidase
Entry information : Pret1CysPrx01
Entry ID 13824
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Pret1CysPrx01
Name Pret1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pret1CysPrx01
start..stop		 S start..stop
Tn1CysPrx 358 3.04e-127 1..224 1..226
Xl1CysPrx 330 5.95e-116 1..224 1..223
Gga1CysPrx 327 1.03e-114 1..224 1..223
Xt1CysPrx 325 4.26e-114 1..224 1..223
Gene structure Fichier Exons►


exon

Literature and cross-references Pret1CysPrx01
Cluster/Prediction ref. Genebank:   103478987
Protein sequence: Pret1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   243
PWM (Da):   %s   26782.66  
PI (pH):   %s   5.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLLLGDKLPNFEVETTAGTMKLHEYFGDSWGILFSHPRDYTPVCTTELGRVARLSGEFSKRDVKLIALSVDNLEDHRGWSDILAYNCEETEGCELPYPIIADSKRKLAVALGMLDPVE
RDKDGIPVTARCVFIIGPDKTLKLSLLYPNTTGRSFDEILRVVDSLQLTAHKRVATPTEWMPGGCVMVPPNMPEEEAAALFPIGVFSKALPSGRKYLRYTPDPLDRKGCEPPPAEPELPT
TL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 17, 4 introns).
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST