1. Browse the Database
  2. View Redoxidase
Entry information : KflGrxC04 (Kfl_000940060)
Entry ID 13959
Creation 2016-10-19 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflGrxC04 (Kfl_000940060)
Name (synonym) KflGrxC04 (Kfl_000940060)
Class CGYC Grx    [Orthogroup: GrxC004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxC04
start..stop		 S start..stop
AtGrxC04 146 1.3e-46 6..132 9..133
HaGrxC03 143 2.57e-45 6..131 10..130
MpalGrxC01 143 3.71e-45 12..124 26..136
MpGrxC01 138 3.21e-43 23..124 38..137
Gene structure Fichier Exons►


exon

Literature and cross-references KflGrxC04 (Kfl_000940060)
Protein sequence: KflGrxC04 (Kfl_000940060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   138 (115)
PWM (Da):   %s   14405.46 (12135.1)  
PI (pH):   %s   5.15 (5.11) Peptide Signal:   %s   cut: 24 range:24-138
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAALVILVLAGLLIAVPQEVGASSDEALQFVKQFIAEHPIAMFS
KSYCPYCARAKQAFKALGPDAEPAVVELDGEDGYAIQDALGELVGRRSVPQVFIDGFHIGGSDDTVDAYQSGKLAKLVAKATGKAASAFNTK

Retrieve as FASTA  
Remarks
DNA ►
Send to BLAST
CDS►
Send to BLAST