Entry information : EferPrx[P]46(Eurfer_11_g19432)
Entry ID | 16798 |
---|---|
Creation | 2020-12-12 (Christophe Dunand) |
Last sequence changes | 2020-12-17 (Christophe Dunand) |
Sequence status | theoretical translation / pseudogene |
Reviewer | Not yet reviewed |
Last annotation changes | 2021-05-05 (Christophe Dunand) |
Peroxidase information: EferPrx[P]46(Eurfer_11_g19432)
Name | EferPrx[P]46(Eurfer_11_g19432) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Class | Class III peroxidase [Orthogroup: Prx103]* | |||||||||||||||||||||||||
Taxonomy | Viridiplantae (green plants); Streptophyta; Angiospermae; Basal Magnoliophyta | |||||||||||||||||||||||||
Organism | Euryale ferox [TaxId: 4414 ] | |||||||||||||||||||||||||
Cellular localisation | N/D |
|||||||||||||||||||||||||
Tissue type | N/D |
|||||||||||||||||||||||||
Inducer | N/D |
|||||||||||||||||||||||||
Repressor | N/D |
|||||||||||||||||||||||||
Best BLASTp hits |
|
Literature and cross-references EferPrx[P]46(Eurfer_11_g19432)
Protein sequence: EferPrx[P]46(Eurfer_11_g19432)
Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
Remarks | incorrect prediction, exon 1 and start of exon 2 are predicted. Eurfer_11_19184273_19185013_g19432.t1_-1_CDS_2836092227_2418. End of sequence found 19184001 to 19184312 and 19183756 to 19184004. 19192784 to 19193173 other last exon, found GAHTIGQSRCSLFRDRIYNDTNIAPLFALKRRLQCPRSGGDDNLAPLDNLTGNRFDNAYYLNLLFKRGLLHSDQQLFNGGAADAQVRTYSLNPLDFSRDFAVAMVKMGNISPLTGTNGQVRTNCRRVN |
||||||||||||
CDS► Send to BLAST |
|