Entry information : EferPrx[P]52(Eurfer_11_g02888)
| Entry ID | 16800 |
|---|---|
| Creation | 2020-12-12 (Christophe Dunand) |
| Last sequence changes | 2020-12-17 (Christophe Dunand) |
| Sequence status | theoretical translation / pseudogene |
| Reviewer | Not yet reviewed |
| Last annotation changes | 2021-05-05 (Christophe Dunand) |
Peroxidase information: EferPrx[P]52(Eurfer_11_g02888)
| Name | EferPrx[P]52(Eurfer_11_g02888) | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Class III peroxidase [Orthogroup: Prx253] | |||||||||||||||||||||||||
| Taxonomy | Viridiplantae (green plants); Streptophyta; Angiospermae; Basal Magnoliophyta | |||||||||||||||||||||||||
| Organism | Euryale ferox [TaxId: 4414 ] | |||||||||||||||||||||||||
| Cellular localisation | N/D |
|||||||||||||||||||||||||
| Tissue type | N/D |
|||||||||||||||||||||||||
| Inducer | N/D |
|||||||||||||||||||||||||
| Repressor | N/D |
|||||||||||||||||||||||||
| Best BLASTp hits |
|
Literature and cross-references EferPrx[P]52(Eurfer_11_g02888)
Protein sequence: EferPrx[P]52(Eurfer_11_g02888)
| Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
| Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
| Remarks | Incorrect prediction, exons 3 and 4 are missing. Eurfer_11_2692245_2692987_g02888.t1_1_CDS_2836091630_5986 End of sequence found 2692946 to 2693503 (2685457 to 2685951, last exon, also found NLQDLVALSGAHTIGQCRCSLFRDRIYNDTNIAPLFALKRRLQCPRSGGDDNLAPLDNLTGNRFDNAYYLNLLFKRGLLHSDQELFNGGAADAQVRTYNFNPLAFSRDFAVAMV*MGNISRLTGTNGQVRTNCRSVN) |
||||||||||||
| CDS► Send to BLAST |
|
||||||||||||
