Entry information : MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
| Entry ID | 17003 |
|---|---|
| Creation | 2021-03-30 (Christophe Dunand) |
| Last sequence changes | 2021-03-30 (Christophe Dunand) |
| Sequence status | theoretical translation / pseudogene |
| Reviewer | Not yet reviewed |
| Last annotation changes | 2021-04-04 (Christophe Dunand) |
Peroxidase information: MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
| Name | MpPrx[P]21(Mapoly0245s0004 / Mp2g25010) | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Class III peroxidase [Orthogroup: N/D] N/D | |||||||||||||||||||||||||
| Taxonomy | Eukaryota Viridiplantae Streptophyta Marchantiaceae Marchantia | |||||||||||||||||||||||||
| Organism | Marchantia polymorpha [TaxId: 3197 ] | |||||||||||||||||||||||||
| Cellular localisation | N/D |
|||||||||||||||||||||||||
| Tissue type | N/D |
|||||||||||||||||||||||||
| Inducer | N/D |
|||||||||||||||||||||||||
| Repressor | N/D |
|||||||||||||||||||||||||
| Best BLASTp hits |
|
Literature and cross-references MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
Protein sequence: MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
| Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
| Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
| Remarks | ¨seudogene form genomic. exons 1 and 2, and end exon 4 are missing. Incorrect prediction from Phytozome (only part of only exon 4). Not found in the two other Mpol ssp , nor in the Mpal A second pseudogene can be found downstream with frames shift and stop in frame. QIEGGSWVVDLGRKDGVVSIAAESMASLPSPFADYTQLVEGFAAVGLSEKDMVVLSGxHTVGRAKCGAFSQRLYGFSGPWAINGTDPTLDPEYAKVLK*QCPQNAHLNTVFLDPSGSFPGQTYDKGYFEAVKANKGVLASDAALLTSSFGASLVAVEAS |
||||||||||||
