Entry information : CsaAPx01 (Cucsa.213340.1)
Entry ID 1901
Creation 2006-09-04 (Christophe Dunand)
Last sequence changes 2011-06-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaAPx01 (Cucsa.213340.1)
Name (synonym) CsaAPx01 (Cucsa.213340.1)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation Cytosolic
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaAPx01
start..stop
S start..stop
CmAPx01 498 0 1..249 1..249
EgrAPx03 459 9.55e-167 1..250 1..250
MtAPx01 456 1.48e-165 1..249 1..250
AandAPx01 456 2.74e-165 1..249 1..250
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1901' 'join(1116441..1116559,1116655..1116829,1116927..1116992,1117494..1117542,1117633..1117715,1117870..1117949,1118032..1118134,1118234..1118292,1118391..1118406)' Exons


exon

Literature and cross-references CsaAPx01 (Cucsa.213340.1)
Literature Amako,K., Sano,S., Miyake,C., Cao,W. and Asada,K. cDNA cloning of cytosolic ascorbate peroxidase from cucumber and its overexpression in Eschrichia coli Unpublished (07-FEB-1999).
Protein ref. GenPept:   1669585 UniProtKB:   Q96399
DNA ref. Phytozome 12:   scaffold01543 (1116441..1118406)
Protein sequence: CsaAPx01 (Cucsa.213340.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   27377.82  
PI (pH):   %s   5.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKCYPVVSEEYQKAIEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFCKDSKTGGPFGTMRFKSELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE
DKPEPPPEGRLPDATKGSDHLRDVFYTMGLSDQDIVALSGGHTLGRAHKERSGFEGPWTTNPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPLVEKYAADEDAFFADYAEAHQK
LSELGFADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs (BAA13671, csa01-2ms3-a11/CK749121).
DNA
Send to BLAST
CDS
Send to BLAST