1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx37 (At4g08770 / PER37 / AtperoxP37 / ATP38)
Entry ID 203
Creation 2006-07-27 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-18 (Christophe Dunand)
Peroxidase information: AtPrx37 (At4g08770 / PER37 / AtperoxP37 / ATP38)
Name (synonym) AtPrx37 (At4g08770 / PER37 / AtperoxP37 / ATP38)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Vascular tissue
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx37
start..stop		 S start..stop
AlyPrx37 656 0 16..346 15..345
AhalPrx37 654 0 1..346 1..346
AhalPrx27 652 0 1..346 1..346
AlyPrx38-1 650 0 1..346 1..346
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx37 (At4g08770 / PER37 / AtperoxP37 / ATP38)
Literature Pedreira J, Herrera MT, Zarra I, Revilla G. The overexpression of AtPrx37, an apoplastic peroxidase, reduces growth in Arabidopsis. Physiol Plant. 2011 Feb;141(2):177-87. PMID: 21044085
Protein ref. UniProtKB:   Q9LDN9
DNA ref. Phytozome 12:   Chr4 (5600262..5598259)
mRNA ref. GenBank:   NM_116947
Cluster/Prediction ref. Phytozome Gene 12:   19644352 UniGene:   At.4181
Omic ref. AtProteome:   At4g08770 ATTED-II:   At4g08770 e-FP Browser:   At4g08770 ePlant:   At4g08770 TAIR:   At4g08770
Protein sequence: AtPrx37 (At4g08770 / PER37 / AtperoxP37 / ATP38)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (324)
PWM (Da):   %s   38047.3 (35645.9)  
PI (pH):   %s   7.72 (7.24) Peptide Signal:   %s   cut: 23 range:23-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHSSLIKLGFLLLLIQVSLSHAQLSPSFYDKTCPQVFDIATTTIV
NALRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFDVIDKMKAAVEKACPKTVSCADLLAIAAQESVVLAGGPSWRVPNGRRDSLRGFMDLANDNLPAPFFTLNQLKDRFKNVGLDRASDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLDKSYLSTLRKQCPRNGNQSVLVDFDLRTPTLFDNKYYVNLKENKGLIQSDQELFSSPDASDTLPLVREYADGQGKFFDAFAKAMIRMSSL
SPLTGKQGEIRLNCRVVNSKSKIMDVVEDALEFASSM

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 4, 3 introns), 4 cDNA and 13 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST