Entry information : PpePrx17 (ppa008569m)
Entry ID 2261
Creation 2005-09-26 (Christophe Dunand)
Last sequence changes 2011-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx17 (ppa008569m)
Name (synonym) PpePrx17 (ppa008569m)
Class Class III peroxidase    [Orthogroup: Prx032]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type Fruits
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx17
start..stop
S start..stop
EgrPrx68 528 0 1..327 1..326
EglPrx68 528 0 1..327 1..326
MguPrx31 524 0 5..326 9..330
EguPrx68 524 0 1..326 1..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2261' 'join(5558612..5558821,5558942..5559139,5559358..5559523,5559710..5560116)' Exons


exon

Literature and cross-references PpePrx17 (ppa008569m)
Literature Vendramin,E., Verde,I., Micali,S., Dettori,M.T. and Quarta,R.
Identification of ESTs related to fruit quality in peach (Prunus persica L). Unpublished (2005).
DNA ref. Phytozome 12:   scaffold_1 (5558612..5560116)
EST ref. GenBank:   DN676971.1 [3' end]
Protein sequence: PpePrx17 (ppa008569m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (303)
PWM (Da):   %s   35658.97 (33171.7)  
PI (pH):   %s   8.71 (8.94) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARSCIVLSALLIPFLLGTACAQLRTDFYKGTCPNVESLVTSAVKTKFQQTFVTAPATLRLFFHDCFVRGCDASVLVQSPTNQAEKDHPDNLSLAGDGFDTVIKAKAAVDSDPNCRNKV
SCADILALATRDVVNLAGGPSYTVELGRRDGRVSTIASVQRRLPHPTFNLDQLNTMFSSHGLTQTDMIALSGAHTLGFSHCNRFSNRIYNFSPAKRIDPTLNSAYALQLRQMCPINVDPR
IAINMDPTTPRTFDNVYFQNLQQGKGLFTSDQILFTDKRAQATINTFASSNAAFNRAFVQAMTKLGRVGVLTGNQGEIRSDCTRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Cultivar "Yumyeong". Incorrect prediction from phytozome (Large 5' fragment missing).
DNA
Send to BLAST
CDS
Send to BLAST