Entry information : SbPrx79 (Sobic.004G156100.1 [2.1] / Sb04g020720 [1.4])
Entry ID 2749
Creation 2008-11-19 (Christophe Dunand)
Last sequence changes 2011-01-21 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx79 (Sobic.004G156100.1 [2.1] / Sb04g020720 [1.4])
Name (synonym) SbPrx79 (Sobic.004G156100.1 [2.1] / Sb04g020720 [1.4])
Class Class III peroxidase    [Orthogroup: Prx075]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx79
start..stop
S start..stop
ZmPrx96 613 0 1..348 1..342
PviPrx01 534 0 1..347 1..341
SiPrx73 517 0 1..347 1..338
TaPrx57-1B 373 1.2e-129 21..347 19..336
Gene structure Fichier Exons


exon

Literature and cross-references SbPrx79 (Sobic.004G156100.1 [2.1] / Sb04g020720 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 12:   chromosome_4 (48763629..48770175)
Protein sequence: SbPrx79 (Sobic.004G156100.1 [2.1] / Sb04g020720 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (320)
PWM (Da):   %s   37366.86 (34566.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.05 (5.72) Peptide Signal:   %s   cut: 29 range:29-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLNATVVAALLSLSVLLAFLAGQSFAGRYYYDKVQDKVRKEVEKAMANNPTIGPALVRLVFHDCWVNGCDGSVLLDRTPTDGTNTEKNATNNIGLAGFEVIDAIKQKVGTDVSCADIV
AFAARDAADILSGGKIFYTLRGGRKDGVVSSAAAADANLPHPNFDFDQLRDNFAAASSRGRSFTVEELVVLSGAHSIGVAHLSSYQDRLLGGPDSTPIDSRYQAALNKTTPPALLESGQN
PTVPNNARDETDAFQEDAAYDAVAMGVNPRRGVLDNSYYHNNLVNKVLFKSDWVLRTDGFAASKLDEYKNNPAEWNSDFAAAMVKLSSLPAQGNKLEIRKNCRVPNQY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 1 and 3'). Very large intron 3 (5300 nt). No EST. Missing 'c'. Containing IntR (3').
DNA
Send to BLAST
CDS
Send to BLAST