Entry information : PtPrx26 (POPTR_0017s06550 / PT00G09300 / Potri.017G037900)
Entry ID 3104
Creation 2010-01-18 (Christophe Dunand)
Last sequence changes 2010-01-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx26 (POPTR_0017s06550 / PT00G09300 / Potri.017G037900)
Name (synonym) PtPrx26 (POPTR_0017s06550 / PT00G09300 / Potri.017G037900)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Leaves
Stems
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx26
start..stop
S start..stop
PtrePrx13 627 0 1..328 1..327
PtPrx27 618 0 1..328 1..327
RcPrx71 548 0 5..328 2..324
MePrx24 546 0 1..328 1..326
Gene structure Fichier Exons


exon

Literature and cross-references PtPrx26 (POPTR_0017s06550 / PT00G09300 / Potri.017G037900)
Literature Ralph,S., et al., Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences. Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 12:   Chr17 (3122525..3123702)
Cluster/Prediction ref. UniGene:   Pth.4282
Omic ref. ePlant:   Potri.017G037900
Protein sequence: PtPrx26 (POPTR_0017s06550 / PT00G09300 / Potri.017G037900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (305)
PWM (Da):   %s   35783.87 (33164.7) Transmb domain:   %s   i3-20o
PI (pH):   %s   8.15 (8.22) Peptide Signal:   %s   cut: 24 range:24-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGFGYFVVMFFCLLVFMGSTEGQLQMGFYSRSCPNAEKIVQDYV
NRHIHNAPSVAATILRMHFHDCFVR
GCDASLLLNTTSSGNQTEKLATPNVTLRGFDFIDRVKSLLEAACPGVVSCADVIALVARDAVVATGGPFWKVPTGRRDGTISRSSEASNNIPPPTSNFTSLQRLFANQGLDLKDLVVLSG
AHTIGVSHCSSFSNRLYNFTGVLGTQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYYGHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFADSMEKMGRIN
VKTGTVGEIRKQCAVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (introns 1 and 2) and 6 ESTs (CV237309, CV246298, DT469378, DT497766, CV250393).
DNA
Send to BLAST
CDS
Send to BLAST