Entry information : MtPrx53 (Medtr4g046713.1[4.0] / contig_56693)
Entry ID 378
Creation 2008-12-30 (Christophe Dunand)
Last sequence changes 2014-07-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-30 (Christophe Dunand)
Peroxidase information: MtPrx53 (Medtr4g046713.1[4.0] / contig_56693)
Name (synonym) MtPrx53 (Medtr4g046713.1[4.0] / contig_56693)
Class Class III peroxidase    [Orthogroup: Prx188]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Arbuscular mycorrhiza (inoculated root)
Roots nodules
Inducers Glomus intraradices infection
Mycorrhiza
Rhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx53
start..stop
S start..stop
PvPrx12 573 0 3..326 1..324
LjPrx14 558 0 3..326 1..323
GmPrx162 552 0 3..326 1..324
GmPrx10 550 0 3..326 1..323
Gene structure Fichier Exons


exon

Literature and cross-references MtPrx53 (Medtr4g046713.1[4.0] / contig_56693)
Literature Journet,E.P. et al., unpublished
DNA ref. GenBank:   CR301985 [5' end]  CR347541 [Fragment] Phytozome 12:   chr4 (16527346..16525688)
Cluster/Prediction ref. Phytozome Gene 12:   31114974 UniGene:   Mtr.16464
Omic ref. Gene atlas:   Mtr.44569.1.S1_at Legoo:   Mtr.44569.1.S1_at
Protein sequence: MtPrx53 (Medtr4g046713.1[4.0] / contig_56693)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   35834.45 (33102.0) Transmb domain:   %s   i7-25o
PI (pH):   %s   8.48 (8.22) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMGNQSYFKVLIICLIAIIGSTHAQLQPGFYAKSCPKAEQIVLKYVHDHIPNAPSLAAALIRLHFHDCFVKGCDASVLLNSTQTNQAEKDAIPNLTLRGYEFIDTIKSLVEKECPGVVS
CADILTLTARDSIHAIGGPYWKVPTGRRDGIISKAADTFTSLPAPFHNLTVLLTLFGNVGLDANDLVLLSGAHTIGVSHCSTISTRLYNFTGKGDQDPDLDNEYAKNLKTFKCKNINDQT
TLIEMDPGSRNTFDLGYFKQVVKRRGLFQSDAALLKSSTTRSILAQHLQSNEKFFTEFGRSMEKMGRINVKIGTEGEIRKHCAFIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 4 ESTs. Cultivar="Jemalong A17".


DNA
Send to BLAST
CDS
Send to BLAST