1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx03 (Glyma15g05650.1)
Entry ID 479
Creation 2006-08-29 (Christophe Dunand)
Last sequence changes 2006-08-29 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx03 (Glyma15g05650.1)
Name (synonym) GmPrx03 (Glyma15g05650.1)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Immature seed coats
Seed coats
Somatic embryos
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx03
start..stop		 S start..stop
GmPrx172 626 0 1..323 1..324
LjPrx72 504 0 1..305 1..304
CclPrx116 487 3.7e-175 1..323 1..322
MtPrx21 481 8.12e-173 18..323 20..323
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx03 (Glyma15g05650.1)
Literature Harris,N. and Gijzen,M. Soybean peroxidase transcripts. Public Soybean EST Project.
Protein ref. UniProtKB:   Q9XFI7
DNA ref. Phytozome 12:   Gm15 (3980112..3983086)
Protein sequence: GmPrx03 (Glyma15g05650.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (303)
PWM (Da):   %s   35033.73 (32826.6)  
PI (pH):   %s   5.19 (5.40) Peptide Signal:   %s   cut: 21 range:21-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFVLSLLFFSFLMGSSESQLQVGFYSNTCPQVDSIIRAVVRDA
VLSDPNMAAVLLRLHFHDCFAQGCDGSILIENGPQSERHAFGHQGVRGFEVIERAKAQLEGSCPGLVSCADIVALAARDAVVMANGPAYQVPTGRRDGLVSNLSLADDMPDVSDSIELLKTKFLNKGLTVKDLVLLSGAHTI
GTTACFFMTRRLYNFFPSGEGSDPAIRQNFLPRLKARCPQNGDVNIRLAIDEGSEQKFDINILKNIREGFAVLESDARLNDDIATKNVIDSYVSPFSPMFGPSFEADFVESVVKMGQIGV
KTGFLGEIRRVCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 9 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST