Entry information : Mgr1CysPrx
Entry ID 4975
Creation 2007-03-11 (Nicolas Rouhier)
Last sequence changes 2012-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-24 (Christophe Dunand)
Peroxidase information: Mgr1CysPrx
Name Mgr1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Magnaporthe
Organism Magnaporthe grisea (Pyricularia grisea)    [TaxId: 148305 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Mgr1CysPrx
start..stop
S start..stop
Nc1CysPrx 405 4.54e-146 1..224 1..224
Gz1CysPrx 379 1.39e-135 7..224 4..221
Pno1CysPrx02 378 2.49e-135 6..224 4..222
Dh1CysPrx 354 4.48e-126 5..221 4..220
Gene structure Fichier Exons


exon

Literature and cross-references Mgr1CysPrx
Literature Dean R.A. et al. The genome sequence of the rice blast fungus Magnaporthe grisea. Nature 434 (7036), 980-986 (2005)
Protein ref. UniProtKB_Uniparc:   A4RJ62
DNA ref. JGI genome:   Supercontig_6.29 (2686918..2687556)
mRNA ref. GenBank:   XP_362792
Protein sequence: Mgr1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24993.98  
PI (pH):   %s   5.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEEQRPAPLRLGTEAPNFKAETTKGPIDFHEFIGSNWVILFSHPEDFTPVCTTELGEFARLEPEFTKRGVKLIGLSANTVGSHDGWIKDINDVTGSHVAFPIIADKERKVAYLYDMLDY
QDTTNVDEKGIAFTIRSVFIIDPAKKIRTILSYPASTGRNSAEVLRIVDSLQTGDKHKVTTPINWVPGDDVIVHPSIKDEQAKDLFPNFRAVKPYLRFTPLPKE

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 1 intron). Strain="70-15".
DNA
Send to BLAST
CDS
Send to BLAST