Entry information : PtPrxQ01 (POPTR_0006s13980 / Potri.006G137500)
Entry ID 6023
Creation 2007-11-30 (Christophe Dunand)
Last sequence changes 2007-11-30 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrxQ01 (POPTR_0006s13980 / Potri.006G137500)
Name (synonym) PtPrxQ01 (POPTR_0006s13980 / Potri.006G137500)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrxQ01
start..stop
S start..stop
PbPrxQ01 426 1.12e-154 1..213 1..214
PtPrxQ02 363 6.98e-130 1..213 1..214
VvPrxQ 347 2.53e-123 1..213 1..217
AdePrxQ 345 1.29e-122 1..209 3..210
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6023' 'join(11218974..11219168,11219249..11219386,11219905..11219994,11220219..11220437)' Exons


exon

Literature and cross-references PtPrxQ01 (POPTR_0006s13980 / Potri.006G137500)
Literature Ralph,S., et al., . Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences. Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 12:   scaffold_6 (11218974..11220437)
EST ref. GenBank:   CV236215
Cluster/Prediction ref. UniGene:   Pth.470  Pth.5589
Omic ref. ePlant:   Potri.006G137500
Protein sequence: PtPrxQ01 (POPTR_0006s13980 / Potri.006G137500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   213
PWM (Da):   %s   23305.26 Transmb domain:   %s   i5-22o
PI (pH):   %s   10.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASISLPKHSLPSLLPTLKPITSSSQNLPILSKSSQSQFYGLKFSHSTSLSIPSSSSVKNTIFAKVNKGQAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYE
KFKKAGAEVVGISGDDPSSHK
AFSKKYRLPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 5 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST