Entry information : AlyKat02
Entry ID 7466
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyKat02
Name AlyKat02
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyKat02
start..stop
S start..stop
AtKat02 1024 0 1..492 1..492
TsKat02 1023 0 1..492 1..492
RsKat01 1021 0 1..492 1..492
BjKat02 1020 0 1..492 1..492
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7466' 'join(2505481..2505495,2505871..2505967,2506133..2506410,2506501..2507277,2507360..2507449,2507548..2507615,2507710..2507803,2507920..2507979)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2505481..2505495 13 N° 2 2505871..2505967 95 N° 3 2506133..2506410 276 N° 4 2506501..2507277 775
N° 5 2507360..2507449 88 N° 6 2507548..2507615 66 N° 7 2507710..2507803 92 N° 8 2507920..2507979 58
join(2505481..2505495,2505871..2505967,2506133..2506410,2506501..2507277,2507360 ..2507449,2507548..2507615,2507710..2507803,2507920..2507979)


exon

Literature and cross-references AlyKat02
DNA ref. Phytozome 12:   scaffold_7 (2505481..2507979)
Protein sequence: AlyKat02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492
PWM (Da):   %s   56751.26  
PI (pH):   %s   7.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
GFAVKFYTR
GNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLLEEDAI
RVGGTNHSHATQDLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYL
QLPVNAPKCAHHNNHHEGFMNFMHRDEE
VNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSADKSLGQKL
ASRLNVRPSI*

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 7, 7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCTTACAAGAGGTAAACCCTTCTTTGCTTTCTCTCTAACCTTTTCGTCTTTTGTTTTTCTCCGTCGAAACTGGATTGAAACGTTGTTATTTAGCCATGGAATTGCACCTAAAGT
TTCGGATTTTCAAACTGTTCCATTAGTGGCGATACTGACATTGATGTAAAGTTTTGACCTTTTTTAAAATAATATGCAAATTATGATTCTTTTTCCATTGCTCTATATTGATTTCTCGAA
GATCGTCTTCTTTTTTTACTCACGGATTTTGCTGGAGGTTTATGTCGTCGATTTGACTTACGATGAATCATTGAGTTTCTCTGATGATGGTTTTGATTTCATCTCCAATTGAATGGGATT
GTTTTTAATCATGTGTATTGGTGATGATGCAGTATCGTCCAGCTAGTTCTTACAACTCTCCATTCTTCACCACCAACTCTGGTGCTCCTGTATGGAACAACAACTCCTCCATGACCGTTG
GACCCAGAG
AGGTACTTCTTCCTCTCCATTTCTACACCAAACCCATTTATATAAGCTGGATATATGAATTTGTGTTGTCTCTATCTTACTATGGTAGTTCTCATACAGTGCAAAGTTTAT
ATGTAAGTGTTAGTGTTGCATTTCTGATTGTATTGGACTGGTTGTTTTTTTGGCAGGTCCTATCCTTCTTGAGGATTACCATCTCGTTGAGAAGCTTGCCAATTTCGACAGGGAACGGAT
TCCAGAGCGTGTGGTTCATGCCAGGGGAGCTAGTGCTAAAGGTTTTTTTGAGGTCACTCATGATATATCTAACCTCACTTGTGCTGACTTTCTCCGAGCTCCTGGTGTTCAGACTCCTGT
CATTGTACGGTTTTCTACCGTTATCCACGAGCGAGGAAGTCCCGAGACCTTGAGAGACCCTCGTGGTTTTGCAGTCAAGTTCTACACCAGAGAG
AGGTCAGTTAGTAGTTTGAACATATT
AGAATGGTAGCAACTACAAGTTCTTGTTGCATATATACTAAGCAATGGATTATTCTTTATATGCAGGGAAACTTTGATCTTGTTGGAAACAACTTTCCGGTTTTCTTCATCCGCGATGGG
ATGAAGTTTCCTGACATGGTTCACGCCCTTAAGCCAAACCCGAAATCTCACATCCAGGAGAACTGGAGAATTCTTGACTTCTTCTCCCACCACCCTGAAAGTTTGAACATGTTCACTTTC
CTCTTCGATGATATCGGTATCCCACAAGATTACAGACACATGGATGGCTCGGGTGTCAACACTTACATGTTGATCAACAAAGCTGGCAAAGCTCACTACGTGAAGTTCCACTGGAAACCA
ACTTGTGGAGTCAAGTCTCTTTTGGAAGAAGATGCGATTCGTGTTGGAGGAACGAACCACAGTCACGCGACTCAGGACTTGTATGACTCAATTGCTGCTGGAAACTACCCTGAATGGAAG
CTCTTTATCCAAATCATTGATCCAGCTGATGAAGACAAGTTCGACTTTGACCCCCTCGATGTGACCAAGACTTGGCCTGAAGATATCTTACCTCTCCAACCTGTTGGACGTATGGTGTTG
AACAAGAACATTGACAACTTCTTTGCAGAGAATGAGCAACTTGCCTTCTGCCCTGCAATTATTGTTCCCGGGATACACTACTCAGACGACAAGCTGCTTCAAACCCGTGTCTTCTCCTAC
GCCGACACTCAGAGACACCGTCTTGGGCCAAACTACCTTCAGCTACCAGTCAATGCCCCAAAATGTGCTCACCACAACAACCACCATGAGGGATTCATGAATTTCATGCACAGGGACGAG
GAG
AGGTACTTACTATGACAATATCTACATCTTTATATCGAACTTAAAGCTAGAATATCATAATCTTACAAGAAGCTGTTGTTACAGGTCAATTACTTCCCGTCGAGGTATGACCCGGTT
CGTCATGCTGAGAAGTATCCAACTCCACCTGCTGTCTGCTCTGGCAAACGTGAGAGG
GGGTCAGTAATCAATTCTGTTTTCCTCTCTGTTTCTGTTTCTCATGGATTGGTTTTACATAAG
AAACATATGTTCTAAAGGCTTGAACTCTGTTTTGCAGTGCATTATTGAGAAAGAGAACAACTTCAAGGAGCCTGGAGAGAGATACCGTTCTTTTACACCAGAGAGAGGTACCAATAGTTT
TTTTCTTTTTCTAATGATACTCTTAATGCATAAGAGAAACATCTGTATTCTTAATGTTTTACGGTTTGATTTCAACTTCAGGCAAGAACGATTCATCCAGAGATGGATTGAAGCCTTATC
CGACCCTCGCATCACGCATGAAATCCGCAGCATCTGGATCTCTTACTGGTCTCAG
AGGTCTGATATCTGAATCTCTTTTACAGTCATTGTCTCTTTCTCCAAGTCTCAGTAGTTGAAAAG
TTGTCAAGTTTTTAACATTTTTGACACTGATGGGTAAAAACTGTGTGAAACAGGCTGACAAGTCTCTGGGACAGAAGCTGGCAAGCCGTCTCAACGTGAGACCAAGCATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCTTACAAGTATCGTCCAGCTAGTTCTTACAACTCTCCATTCTTCACCACCAACTCTGGTGCTCCTGTATGGAACAACAACTCCTCCATGACCGTTGGACCCAGAGGTCCTATC
CTTCTTGAGGATTACCATCTCGTTGAGAAGCTTGCCAATTTCGACAGGGAACGGATTCCAGAGCGTGTGGTTCATGCCAGGGGAGCTAGTGCTAAAGGTTTTTTTGAGGTCACTCATGAT
ATATCTAACCTCACTTGTGCTGACTTTCTCCGAGCTCCTGGTGTTCAGACTCCTGTCATTGTACGGTTTTCTACCGTTATCCACGAGCGAGGAAGTCCCGAGACCTTGAGAGACCCTCGT
GGTTTTGCAGTCAAGTTCTACACCAGAGAG
GGAAACTTTGATCTTGTTGGAAACAACTTTCCGGTTTTCTTCATCCGCGATGGGATGAAGTTTCCTGACATGGTTCACGCCCTTAAGCCA
AACCCGAAATCTCACATCCAGGAGAACTGGAGAATTCTTGACTTCTTCTCCCACCACCCTGAAAGTTTGAACATGTTCACTTTCCTCTTCGATGATATCGGTATCCCACAAGATTACAGA
CACATGGATGGCTCGGGTGTCAACACTTACATGTTGATCAACAAAGCTGGCAAAGCTCACTACGTGAAGTTCCACTGGAAACCAACTTGTGGAGTCAAGTCTCTTTTGGAAGAAGATGCG
ATTCGTGTTGGAGGAACGAACCACAGTCACGCGACTCAGGACTTGTATGACTCAATTGCTGCTGGAAACTACCCTGAATGGAAGCTCTTTATCCAAATCATTGATCCAGCTGATGAAGAC
AAGTTCGACTTTGACCCCCTCGATGTGACCAAGACTTGGCCTGAAGATATCTTACCTCTCCAACCTGTTGGACGTATGGTGTTGAACAAGAACATTGACAACTTCTTTGCAGAGAATGAG
CAACTTGCCTTCTGCCCTGCAATTATTGTTCCCGGGATACACTACTCAGACGACAAGCTGCTTCAAACCCGTGTCTTCTCCTACGCCGACACTCAGAGACACCGTCTTGGGCCAAACTAC
CTTCAGCTACCAGTCAATGCCCCAAAATGTGCTCACCACAACAACCACCATGAGGGATTCATGAATTTCATGCACAGGGACGAGGAG
GTCAATTACTTCCCGTCGAGGTATGACCCGGTT
CGTCATGCTGAGAAGTATCCAACTCCACCTGCTGTCTGCTCTGGCAAACGTGAGAGG
TGCATTATTGAGAAAGAGAACAACTTCAAGGAGCCTGGAGAGAGATACCGTTCTTTTACACCA
GAGAG
GCAAGAACGATTCATCCAGAGATGGATTGAAGCCTTATCCGACCCTCGCATCACGCATGAAATCCGCAGCATCTGGATCTCTTACTGGTCTCAGGCTGACAAGTCTCTGGGACAG
AAGCTGGCAAGCCGTCTCAACGTGAGACCAAGCATCTAA

Retrieve as FASTA